PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G139800.1.p
Common NameSb01g012170, SORBIDRAFT_01g012170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRF
Protein Properties Length: 436aa    MW: 47572.4 Da    PI: 9.2918
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G139800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.26.8e-24165209145
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           d+epgrCrRtDGKkWRCs+++++++k+CErH++r+r+rsrk++e+
  Sobic.001G139800.1.p 165 DPEPGRCRRTDGKKWRCSKEAMADHKYCERHINRNRHRSRKPVEN 209
                           79****************************************997 PP

2QLQ57.25.1e-20107142237
                   QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                           +FT++Q+++L++Q+l+yKyL+a++P+P+ Ll  i+k
  Sobic.001G139800.1.p 107 PFTPSQWMELEHQALIYKYLNAKAPIPSSLLISISK 142
                           9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.6E-11106142IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.6E-14107140IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.762107142IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.803165209IPR014977WRC domain
PfamPF088793.8E-20166208IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MSAEFCAAAG GGGAAVAMEF GVVGDVMGLQ QGIAVTAPSP RDSSDLGLLK RAALTQAAAA  60
AAAPYPSPFL DEQKMLRFSK AAHTLPSGLD FGGPSEQAFL LSRTKRPFTP SQWMELEHQA  120
LIYKYLNAKA PIPSSLLISI SKSFRSSNRV SWRPLYQGYT NADSDPEPGR CRRTDGKKWR  180
CSKEAMADHK YCERHINRNR HRSRKPVENQ PKKTTKEVPA AAGSLPCAGP QGSLKKAKVN  240
DSKPGTVSYW TDNLNRTMLN REKANKLTED NSLLLNSTNS QPTLSLLSQL KQQNKPDKLG  300
PTLENESNSD TILKAWGGNQ PSHKGISSAQ RHDADSLQSV LQNFSLAQNE KMESEKNKYS  360
DSMLVSSTFY SADGPRSTCL TPNMTQVQQD CISSSWEMPQ GGPLGEILSN NKNSEDLSKC  420
ESRSYGWLLN LDQAP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9610320.0EU961032.1 Zea mays clone 230596 atGRF2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466681.10.0hypothetical protein SORBIDRAFT_01g012170
SwissprotQ9FRG80.0GRF9_ORYSJ; Growth-regulating factor 9
TrEMBLC5WPQ00.0C5WPQ0_SORBI; Putative uncharacterized protein Sb01g012170
STRINGSb01g012170.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131242529
Representative plantOGRP1393344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-36growth-regulating factor 1